Return to main results Retrieve Phyre Job Id

Job DescriptionP19381
Confidence3.52%DateThu Jan 5 11:37:20 GMT 2012
Rank83Aligned Residues22
% Identity45%Templatec1b9uA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:protein (atp synthase); PDBTitle: membrane domain of the subunit b of the e.coli atp synthase
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   191........200.........210.........220....
Predicted Secondary structure 


Query SS confidence 

































Query Sequence  NATAFGSLTAWLRLLRNTVVSIICLLMWICLVYI
Query Conservation 

































Alig confidence 











............









Template Conservation 


  

 
 
 ............









Template Sequence  NATILGQAIAFV. . . . . . . . . . . . LFVLFCMKYV
Template Known Secondary structure  ............T
Template Predicted Secondary structure  ............
Template SS confidence 

































   4.....10..... ....20.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions