Return to main results Retrieve Phyre Job Id

Job DescriptionP17802
Confidence43.24%DateThu Jan 5 11:36:16 GMT 2012
Rank190Aligned Residues37
% Identity14%Templatec2rrdA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:hrdc domain from bloom syndrome protein; PDBTitle: structure of hrdc domain from human bloom syndrome protein, blm
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   87..90.........100.. .......110.........120...
Predicted Secondary structure 


................









Query SS confidence 















. . . . . . . . . . . . . . . .




















Query Sequence  RNLHKAAQQVATLHGG. . . . . . . . . . . . . . . . KFPETFEEVAALPGVGRSTAG
Query Conservation    
   
  
     
................  
     
  




  

 
Alig confidence 















................




















Template Conservation    
   
  

    
    
  
  
  

   
 
  

  
 

   
  
Template Sequence  GELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLE
Template Known Secondary structure  TT







TSTT

Template Predicted Secondary structure 













Template SS confidence 




















































   26...30.........40.........50.........60.........70........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions