Return to main results Retrieve Phyre Job Id

Job DescriptionP17802
Confidence90.01%DateThu Jan 5 11:36:16 GMT 2012
Rank131Aligned Residues38
% Identity34%Templatec2owoA_
PDB info PDB header:ligase/dnaChain: A: PDB Molecule:dna ligase; PDBTitle: last stop on the road to repair: structure of e.coli dna ligase bound2 to nicked dna-adenylate
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80.........90.........100.........110.........120........
Predicted Secondary structure 





















Query SS confidence 











































































Query Sequence  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSL
Query Conservation         
    

 
            
 
 

  
   
  
     
  
     
  




  

  

  
Alig confidence 



















......................................

















Template Conservation    

  
 

  
  
  
 ......................................
  
 


   
 

   
Template Sequence  AGLAAYFGTLEALEAASIEE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LQKVPDVGIVVASHVHNF
Template Known Secondary structure 
ST

......................................TTSTT

Template Predicted Secondary structure 




......................................




Template SS confidence 











































































   526...530.........540..... ....550.........560...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions