Return to main results Retrieve Phyre Job Id

Job DescriptionP76421
Confidence10.92%DateThu Jan 5 12:22:55 GMT 2012
Rank56Aligned Residues25
% Identity12%Templatec2rirA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:dipicolinate synthase, a chain; PDBTitle: crystal structure of dipicolinate synthase, a chain, from bacillus2 subtilis
Resolution2.79 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   70.........80.........90.........
Predicted Secondary structure 











Query SS confidence 





























Query Sequence  IDVSRWQERIDWQRVAKMRDNGIRLQFAFI
Query Conservation 



  

 


  
        

 



Alig confidence 
















.....







Template Conservation 

 
   
 

      .....        
Template Sequence  LDLASRPGGTDFKYAEK. . . . . QGIKALLA
Template Known Secondary structure 
SSTT
SB
.....T

Template Predicted Secondary structure 








.....

Template SS confidence 





























   240.........250...... ...260....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions