Return to main results Retrieve Phyre Job Id

Job DescriptionP76421
Confidence7.11%DateThu Jan 5 12:22:55 GMT 2012
Rank87Aligned Residues26
% Identity19%Templatec2i9iA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein; PDBTitle: crystal structure of helicobacter pylori protein hp0492
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   45....50.........60.........70......
Predicted Secondary structure 






















Query SS confidence 































Query Sequence  YIHFYGYRPVKSFAIRIPASYTIHGIDVSRWQ
Query Conservation                          




  
Alig confidence 














......










Template Conservation   
  

 

 
   
......


 



   
Template Sequence  SVWFNFYEPESNRVV. . . . . . HDFAVEVGTFQ
Template Known Secondary structure 
TTT

......



Template Predicted Secondary structure 






......
Template SS confidence 































   175....180......... 190.........200
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions