Return to main results Retrieve Phyre Job Id

Job DescriptionQ9S4X2
Confidence57.89%DateThu Jan 5 12:38:25 GMT 2012
Rank291Aligned Residues48
% Identity10%Templatec3i53A_
PDB info PDB header:transferaseChain: A: PDB Molecule:o-methyltransferase; PDBTitle: crystal structure of an o-methyltransferase (ncsb1) from2 neocarzinostatin biosynthesis in complex with s-adenosyl-l-3 homocysteine (sah)
Resolution2.08 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   48.50.........60.........70. ........80.........90.....
Predicted Secondary structure 




...................










Query SS confidence 























. . . . . . . . . . . . . . . . . . .























Query Sequence  DEWLQPACNEMYRVLKKDALMVSF. . . . . . . . . . . . . . . . . . . YGWNRVDRFMAAWKNAGFSVVGHL
Query Conservation         
 
  



  
   
 ...................            
   
      
Alig confidence 























...................























Template Conservation         
      
 


 


 
         
        
   
  
    
  


      
Template Sequence  DLSAVAILRRCAEAAGSGGVVLVIEAVAGAGTGMDLRMLTYFGGKERSLAELGELAAQAGLAVRAAH
Template Known Secondary structure  TTT






S




TT
Template Predicted Secondary structure 
























Template SS confidence 


































































   250.........260.........270.........280.........290.........300.........310......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions