Return to main results Retrieve Phyre Job Id

Job DescriptionQ9S4X2
Confidence96.65%DateThu Jan 5 12:38:25 GMT 2012
Rank130Aligned Residues50
% Identity20%Templatec2hteB_
PDB info PDB header:transferaseChain: B: PDB Molecule:spermidine synthase; PDBTitle: the crystal structure of spermidine synthase from p. falciparum in2 complex with 5'-methylthioadenosine
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 





























Query SS confidence 






































































Query Sequence  RFIQGDCVRVMATFPGNAVDFILTDPPYLVGFRDRQGRTIAGDKTDEWLQPACNEMYRVLKKDALMVSFYG
Query Conservation   
  

  
 
  
   










                
       
 
  



  
   
   
Alig confidence 












.














....................





















Template Conservation       
    
  .    

 

 
    ....................  
       
 





    
Template Sequence  NVFIEDASKFLEN. VTNTYDVIIVDSSDN. . . . . . . . . . . . . . . . . . . . QNFYEKIYNALKPNGYCVAQCE
Template Known Secondary structure  S
T.

S




....................

Template Predicted Secondary structure 


.








....................






Template SS confidence 






































































   135....140....... ..150.........160.. .......170.........180....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions