Return to main results Retrieve Phyre Job Id

Job DescriptionP76296
Confidence2.83%DateThu Jan 5 12:21:38 GMT 2012
Rank19Aligned Residues28
% Identity29%Templatec3kpaB_
PDB info PDB header:ligaseChain: B: PDB Molecule:probable ubiquitin fold modifier conjugating enzyme; PDBTitle: ubiquitin fold modifier conjugating enzyme from leishmania major2 (probable)
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70.........80.........90.........100.
Predicted Secondary structure 



Query SS confidence 











































Query Sequence  NLVDAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAW
Query Conservation    

 


  
  
   
   
       
      
   

 
Alig confidence 















................











Template Conservation    
  





 


 ................

  

  
 

Template Sequence  DKWTARLKEEYASLIT. . . . . . . . . . . . . . . . YVEHNKASDSHW
Template Known Secondary structure  ................TT


Template Predicted Secondary structure  ................




Template SS confidence 











































   25....30.........40 .........50..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions