Return to main results Retrieve Phyre Job Id

Job DescriptionP24205
Confidence18.37%DateThu Jan 5 11:41:14 GMT 2012
Rank28Aligned Residues41
% Identity12%Templatec2ps3A_
PDB info PDB header:metal transportChain: A: PDB Molecule:high-affinity zinc uptake system protein znua; PDBTitle: structure and metal binding properties of znua, a2 periplasmic zinc transporter from escherichia coli
Resolution2.47 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   191........200.........210.........220.........230.........240.......
Predicted Secondary structure 


















Query SS confidence 
























































Query Sequence  IKPFIQSVRQGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCRARVVPL
Query Conservation   
 
   

 
  
 

 

      

 
 


  
 
  


 

 
  





Alig confidence 
























................















Template Conservation 
  
   

   
  

 
      ................    

   
   
 
Template Sequence  LHEIRTQLVEQKATCVFAEPQFRPA. . . . . . . . . . . . . . . . VVESVARGTSVRMGTL
Template Known Secondary structure  TT
S
TTS
................TTSS

Template Predicted Secondary structure 








................

Template SS confidence 
























































   238.240.........250.........260.. .......270........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions