Return to main results Retrieve Phyre Job Id

Job DescriptionP19934
Confidence7.00%DateThu Jan 5 11:37:42 GMT 2012
Rank94Aligned Residues35
% Identity29%Templatec1yq3C_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:succinate dehydrogenase cytochrome b, large subunit; PDBTitle: avian respiratory complex ii with oxaloacetate and ubiquinone
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10...... ...20.........30.....
Predicted Secondary structure 



............
Query SS confidence 















. . . . . . . . . . . .


















Query Sequence  MSKATEQNDKLKRAII. . . . . . . . . . . . ISAVLHVILFAALIWSSFD
Query Conservation                  ............

  

  
   
      
Alig confidence 















............


















Template Conservation         
 
  

 



 


   
 
 








 
      
Template Sequence  MARFWEKNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSL
Template Known Secondary structure  TS






TTT



Template Predicted Secondary structure 














Template SS confidence 














































   910.........20.........30.........40.........50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions