Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFX4
Confidence3.19%DateThu Jan 5 11:27:29 GMT 2012
Rank96Aligned Residues33
% Identity24%Templatec3skqA_
PDB info PDB header:metal transportChain: A: PDB Molecule:mitochondrial distribution and morphology protein 38; PDBTitle: mdm38 is a 14-3-3-like receptor and associates with the protein2 synthesis machinery at the inner mitochondrial membrane
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   27..30.........40...... ...50.........
Predicted Secondary structure 








.........................



Query SS confidence 



















. . . . . . . . . . . . . . . . . . . . . . . . .












Query Sequence  KHLLVAYYNLVGIKPGKESY. . . . . . . . . . . . . . . . . . . . . . . . . MRLNEKALDDFCQ
Query Conservation 
 


 

 



 
     .........................  
    

 


Alig confidence 



















.........................












Template Conservation 
 

 



 
 
  


   

 


 

  

 

  
  






  

  

 
Template Sequence  RPQLAAMSKFMSLRPFGNDNMLRYQIRSKLKDIMNDDKTIDYEGVESLSQEELYQACV
Template Known Secondary structure  TT



SS
GGGS
Template Predicted Secondary structure 












Template SS confidence 

























































   259260.........270.........280.........290.........300.........310......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions