Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFX4
Confidence3.65%DateThu Jan 5 11:27:29 GMT 2012
Rank75Aligned Residues23
% Identity35%Templatec2rklB_
PDB info PDB header:lipid transportChain: B: PDB Molecule:vacuolar protein sorting-associated protein vta1; PDBTitle: crystal structure of s.cerevisiae vta1 c-terminal domain
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   102.......110.........120.........130.
Predicted Secondary structure 








Query SS confidence 





























Query Sequence  QIMDYYDSSLETAIDHDNYLEFQQVLSDIG
Query Conservation    
 




               


 

Alig confidence 






..






.....








Template Conservation 


 


..
 

   .....
 


 

 
Template Sequence  SALNYED. . LPTAKDE. . . . . LTKALDLLN
Template Known Secondary structure  TT
.......
Template Predicted Secondary structure 
.......
Template SS confidence 





























   306...310.. ....... 320........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions