Return to main results Retrieve Phyre Job Id

Job DescriptionP0C079
Confidence8.86%DateThu Jan 5 11:29:49 GMT 2012
Rank85Aligned Residues24
% Identity17%Templated1iwga5
SCOP infoMultidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains
Resolution3.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30....
Predicted Secondary structure 




Query SS confidence 






























Query Sequence  INLRIDDELKARSYAALEKMGVTPSEALRLM
Query Conservation 
  


  

  
  

   

  
 

  
Alig confidence 







.......















Template Conservation 


 


 .......

   


   
  

Template Sequence  MRIWMNPN. . . . . . . ELNKFQLTPVDVITAI
Template Known Secondary structure 
.......TTT

Template Predicted Secondary structure 
.......



Template SS confidence 






























   184.....190. ........200.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions