Return to main results Retrieve Phyre Job Id

Job DescriptionQ47702
Confidence6.47%DateThu Jan 5 12:37:06 GMT 2012
Rank48Aligned Residues31
% Identity19%Templatec3nqwB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:cg11900; PDBTitle: a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in2 starvation responses
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   88.90........ .100.........110........
Predicted Secondary structure 





............






Query SS confidence 










. . . . . . . . . . . .



















Query Sequence  TGKPYIVKIPG. . . . . . . . . . . . KSDENAQPFLHALIAQTDKT
Query Conservation 




 
 
 
............     
  

 
 
    
 
Alig confidence 










............



















Template Conservation 

 

  
   

 

       
 
 
 










  
Template Sequence  QETPYVNHVINVSTILSVEACITDEGVLMAALLHDVVEDTDAS
Template Known Secondary structure  S

BTS



TTTSS

Template Predicted Secondary structure 













Template SS confidence 










































   2930.........40.........50.........60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions