Return to main results Retrieve Phyre Job Id

Job DescriptionQ47702
Confidence5.72%DateThu Jan 5 12:37:06 GMT 2012
Rank56Aligned Residues26
% Identity31%Templatec2jobA_
PDB info PDB header:lipid binding proteinChain: A: PDB Molecule:antilipopolysaccharide factor; PDBTitle: solution structure of an antilipopolysaccharide factor from2 shrimp and its possible lipid a binding site
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   72.......80.........90.........100.........
Predicted Secondary structure 












Query SS confidence 





































Query Sequence  DTAEQFIDKVASSSSITGKPYIVKIPGKSDENAQPFLH
Query Conservation   


 

   




 




 
 
 
     
  

 
Alig confidence 
















............








Template Conservation   
  


 

   



............
  
  

 
Template Sequence  KTAKDFVRKAFQKGLIS. . . . . . . . . . . . QQEANQWLS
Template Known Secondary structure  T
S
............
Template Predicted Secondary structure 



............
Template SS confidence 





































   76...80.........90.. .......100.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions