Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEB7
Confidence12.58%DateThu Jan 5 11:22:58 GMT 2012
Rank53Aligned Residues24
% Identity25%Templated1r5pa_
SCOP infoThioredoxin fold Thioredoxin-like KaiB-like
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50..
Predicted Secondary structure 








Query SS confidence 































Query Sequence  TLYYTGVPENLDADAFEQTANTLAQIDAVLEK
Query Conservation   
 


       
   
    
 

   
  
Alig confidence 








........














Template Conservation   


 
 
 ........ 
  

 

  


 
Template Sequence  KLYVAGNTP. . . . . . . . NSVRALKTLKNILEQ
Template Known Secondary structure  SS

........
Template Predicted Secondary structure 


........
Template SS confidence 































   11........ 20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions