Return to main results Retrieve Phyre Job Id

Job DescriptionP33025
Confidence33.50%DateThu Jan 5 11:51:01 GMT 2012
Rank62Aligned Residues24
% Identity58%Templatec2yvqA_
PDB info PDB header:ligaseChain: A: PDB Molecule:carbamoyl-phosphate synthase; PDBTitle: crystal structure of mgs domain of carbamoyl-phosphate2 synthetase from homo sapiens
Resolution1.98 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   121........130.........140.........150.........160.........170.........180.....
Predicted Secondary structure 




























Query SS confidence 
































































Query Sequence  ALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVVCAGAKSILDLGLTTEYLETFGVPL
Query Conservation    


 












 
 
 





 

 



 

 

 





  


 


 

 
Alig confidence 











.........................................











Template Conservation    

  
 

 
.........................................

  
   

 
Template Sequence  HNEGFKLFATEA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TSDWLNANNVPA
Template Known Secondary structure  TTT
.........................................TT


Template Predicted Secondary structure 




.........................................



Template SS confidence 
































































   1382.......1390... ......1400.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions