Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAP7
Confidence5.60%DateThu Jan 5 11:13:27 GMT 2012
Rank6Aligned Residues26
% Identity50%Templated2axtm1
SCOP infoSingle transmembrane helix Photosystem II reaction center protein M, PsbM PsbM-like
Resolution3.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40.........50.........60...
Predicted Secondary structure 




Query SS confidence 








































Query Sequence  GNIAYALFVLFCFWAGAQLLNLLVHAPGVYERLMQVQETGR
Query Conservation    


 



 
 




 
  






 




 
   
Alig confidence 










...............














Template Conservation 




 




...............











 
 
Template Sequence  GLIATALFVLV. . . . . . . . . . . . . . . PSVFLIILYVQTESQ
Template Known Secondary structure  ...............GG
Template Predicted Secondary structure  ...............
Template SS confidence 








































   7..10....... ..20.........30..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions