Return to main results Retrieve Phyre Job Id

Job DescriptionP32051
Confidence7.29%DateWed Jan 25 15:20:49 GMT 2012
Rank31Aligned Residues30
% Identity23%Templatec4a1dH_
PDB info PDB header:ribosomeChain: H: PDB Molecule:rpl35a; PDBTitle: t.thermophila 60s ribosomal subunit in complex with initiation2 factor 6. this file contains 26s rrna and proteins of3 molecule 4.
Resolution3.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40....
Predicted Secondary structure 















Query SS confidence 







































Query Sequence  YRVIWNCTLQVFQACSELTRRAGKTSTVNLRKSSGLTTKF
Query Conservation 





   
  







  

                
Alig confidence 






..........






















Template Conservation   
 



..........
 
 










  


 

Template Sequence  YRTIWGR. . . . . . . . . . IGKAHGNNGVAVARFAHNLPPQA
Template Known Secondary structure  ..........
STTTSS


GGG
Template Predicted Secondary structure  ..........










Template SS confidence 







































   70...... ...80.........90.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions