Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC78
Confidence3.91%DateThu Jan 5 11:17:29 GMT 2012
Rank19Aligned Residues28
% Identity21%Templatec2rddB_
PDB info PDB header:membrane protein/transport proteinChain: B: PDB Molecule:upf0092 membrane protein yajc; PDBTitle: x-ray crystal structure of acrb in complex with a novel2 transmembrane helix.
Resolution3.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   325....330.........340.........350.........360
Predicted Secondary structure 


Query SS confidence 



































Query Sequence  VLFLLAFFLYGYCIKRAWKVARFIKRVKRRLRRNRG
Query Conservation                                      
Alig confidence 













........













Template Conservation 
   
    




........ 






 


  
Template Sequence  ILMLVVFGLIFYFM. . . . . . . . ILRPQQKRTKEHKK
Template Known Secondary structure  ........TTT
Template Predicted Secondary structure  ........
Template SS confidence 



































   24.....30....... ..40.........50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions