Return to main results Retrieve Phyre Job Id

Job DescriptionP25740
Confidence38.04%DateThu Jan 5 11:42:26 GMT 2012
Rank340Aligned Residues31
% Identity19%Templatec2ew2B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:2-dehydropantoate 2-reductase, putative; PDBTitle: crystal structure of the putative 2-dehydropantoate 2-reductase from2 enterococcus faecalis
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40
Predicted Secondary structure 











Query SS confidence 






































Query Sequence  IVAFCLYKYFPFGGLQRDFMRIASTVAARGHHVRVYTQS
Query Conservation 

  
     
 

       

  
   
  
 
    
Alig confidence 




........

























Template Conservation 

 

........


  
   
  
   
  

   
 
Template Sequence  KIAIA. . . . . . . . GAGAXGSRLGIXLHQGGNDVTLIDQW
Template Known Secondary structure  ........S
STT

S
Template Predicted Secondary structure  ........







Template SS confidence 






































   2.... ...10.........20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions