Return to main results Retrieve Phyre Job Id

Job DescriptionP0AGJ2
Confidence16.81%DateThu Jan 5 11:29:18 GMT 2012
Rank62Aligned Residues28
% Identity25%Templatec2jg6A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:dna-3-methyladenine glycosidase; PDBTitle: crystal structure of a 3-methyladenine dna glycosylase i2 from staphylococcus aureus
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   193......200.........210.........220.........
Predicted Secondary structure 














Query SS confidence 




































Query Sequence  PVLAKVAKRKGLPYPHVNQQGEIEADADWWATMQAAG
Query Conservation            
  

     
                
Alig confidence 












.........














Template Conservation    










.........




  





 
Template Sequence  TQLSKDLKQYGFK. . . . . . . . . FLGPVTVFSFLEAAG
Template Known Secondary structure  TTT

.........S

TT
Template Predicted Secondary structure  .........



Template SS confidence 




































   143......150..... ....160.........170
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions