Return to main results Retrieve Phyre Job Id

Job DescriptionP15006
Confidence2.83%DateThu Jan 5 11:34:09 GMT 2012
Rank74Aligned Residues45
% Identity16%Templatec3ko7E_
PDB info PDB header:hydrolaseChain: E: PDB Molecule:d-tyrosyl-trna(tyr) deacylase; PDBTitle: dtd from plasmodium falciparum in complex with d-lysine
Resolution2.21 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   198.200.........210.........220.........230.........240.........250.. .......
Predicted Secondary structure 
































.
Query SS confidence 






















































.






Query Sequence  SLLYQKFLYEFCRRELTSANTTRSYLKWDASSISDQSLNLLPRMETDITIRSSEK. ILIVDAK
Query Conservation    


  
   
   
                           
 




     . 





Alig confidence 




























.................








.






Template Conservation    

  
   

       
  
 


 
................. 
 
 






 


 
Template Sequence  LIFYNKIIDEFKKQYNDDKIKIGKFGNYM. . . . . . . . . . . . . . . . . NIDVTNDGPVTIYIDTH
Template Known Secondary structure  S
TTS

SSS

.................TT
Template Predicted Secondary structure 








.................




Template SS confidence 






























































   113......120.........130.........140. ........150........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions