Return to main results Retrieve Phyre Job Id

Job DescriptionP15006
Confidence28.76%DateThu Jan 5 11:34:09 GMT 2012
Rank15Aligned Residues28
% Identity18%Templatec2gq1A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:fructose-1,6-bisphosphatase; PDBTitle: crystal structure of recombinant type i fructose-1,6-bisphosphatase2 from escherichia coli complexed with sulfate ions
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   277..280.........290.........300.........310......
Predicted Secondary structure 



















Query SS confidence 







































Query Sequence  QNLYQLMNYLWSLKPENGENIGGLLIYPHVDTAVKHRYKI
Query Conservation   




 

             
 



            
Alig confidence 









............

















Template Conservation 

 

 
  
............


 

       




Template Sequence  ADFHRNLLKG. . . . . . . . . . . . GIYLYPSTASHPDGKLRL
Template Known Secondary structure 
............



SSSTT
SSBT
Template Predicted Secondary structure 
............











Template SS confidence 







































   245....250.... .....260.........270..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions