Return to main results Retrieve Phyre Job Id

Job DescriptionP15006
Confidence4.46%DateThu Jan 5 11:34:09 GMT 2012
Rank32Aligned Residues44
% Identity18%Templatec2dboA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:d-tyrosyl-trna(tyr) deacylase; PDBTitle: crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus
Resolution2.76 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   198.200.........210.........220.........230.........240.........250.........
Predicted Secondary structure 
































Query SS confidence 





























































Query Sequence  SLLYQKFLYEFCRRELTSANTTRSYLKWDASSISDQSLNLLPRMETDITIRSSEKILIVDAK
Query Conservation    


  
   
   
                           
 




      





Alig confidence 










.

























.................






Template Conservation    

  
   
.
     
  
 


 
 
 
 




.................

 


 
Template Sequence  KELYEKFVDKI. KESGLKVETGIFGAMMDVFIENWGPV. . . . . . . . . . . . . . . . . TIIIDSR
Template Known Secondary structure  .TT
S


SSS

.................GG
Template Predicted Secondary structure  .













.................

Template SS confidence 





























































   103......110... ......120.........130......... 140......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions