Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADU2
Confidence3.08%DateThu Jan 5 11:21:51 GMT 2012
Rank71Aligned Residues19
% Identity16%Templated3e9va1
SCOP infoBTG domain-like BTG domain-like BTG domain-like
Resolution1.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40.........50.........60....
Predicted Secondary structure 














Query SS confidence 





























Query Sequence  EGCHGYAPMVDCAAGVSFQSMAPDSIVMIE
Query Conservation 



 
    
          

      
Alig confidence 









...........








Template Conservation 
 


 
 

........... 
   


 
Template Sequence  PYEVSYRIGE. . . . . . . . . . . DGSICVLYE
Template Known Secondary structure  TTST...........TS
Template Predicted Secondary structure 




...........



Template SS confidence 





























   107..110...... ...120.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions