Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADU2
Confidence1.86%DateThu Jan 5 11:21:51 GMT 2012
Rank91Aligned Residues54
% Identity19%Templatec2djwF_
PDB info PDB header:unknown functionChain: F: PDB Molecule:probable transcriptional regulator, asnc family; PDBTitle: crystal structure of ttha0845 from thermus thermophilus hb8
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70....
Predicted Secondary structure 
























Query SS confidence 









































































Query Sequence  MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEA
Query Conservation 

 

     


          
       
 




 
    
          

      
 
 
  

  
Alig confidence 













.........


















...........




















Template Conservation 

 
 
 
      .........   
   
   


     ...........


  
    
   
   
  
Template Sequence  MITAFVLIRPRGNR. . . . . . . . . VQALGEAIAELPQVAEVYS. . . . . . . . . . . VTGPYDLVALVRLKDVEELDD
Template Known Secondary structure 

GGG.........TTSTT...........
SSSSSSSSTT
Template Predicted Secondary structure 




.........



...........





Template SS confidence 









































































   1........10.... .....20.........30... ......40.........50....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions