Return to main results Retrieve Phyre Job Id

Job DescriptionP75786
Confidence1.01%DateWed Jan 25 15:21:02 GMT 2012
Rank94Aligned Residues26
% Identity27%Templatec3eebB_
PDB info PDB header:toxinChain: B: PDB Molecule:rtx toxin rtxa; PDBTitle: structure of the v. cholerae rtx cysteine protease domain
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.......
Predicted Secondary structure 







Query SS confidence 
































Query Sequence  LQEDRASRRSGQLLTNKSFAKGIANPTKSGVFQ
Query Conservation 
































Alig confidence 
















.......








Template Conservation 

 
     

  

 
.......

 





Template Sequence  MENDPVVAKAAANLAGK. . . . . . . HAESSVVVQ
Template Known Secondary structure 
S

.......TGGG
Template Predicted Secondary structure 


.......



Template SS confidence 
































   38.40.........50.... .....60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions