Return to main results Retrieve Phyre Job Id

Job DescriptionP15081
Confidence2.44%DateThu Jan 5 11:34:37 GMT 2012
Rank78Aligned Residues26
% Identity15%Templatec1x5bA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:signal transducing adaptor molecule 2; PDBTitle: the solution structure of the vhs domain of human signal2 transducing adaptor molecule 2
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20.. .......30.........
Predicted Secondary structure  .......

Query SS confidence 








. . . . . . .
















Query Sequence  CAQLALGGW. . . . . . . QISRFNRAFDTLCQQGR
Query Conservation 


  
   .......


 

     


 
 
Alig confidence 








.......
















Template Conservation 

 

  
   
     
      
  

  
 
Template Sequence  LKSLMVEWSEEFQKDPQFSLISATIKSMKEEGI
Template Known Secondary structure  TTT
STTTTT
Template Predicted Secondary structure 






Template SS confidence 
































   116...120.........130.........140........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions