Return to main results Retrieve Phyre Job Id

Job DescriptionP31447
Confidence6.63%DateThu Jan 5 11:47:37 GMT 2012
Rank82Aligned Residues32
% Identity22%Templatec3dqzB_
PDB info PDB header:lyaseChain: B: PDB Molecule:alpha-hydroxynitrile lyase-like protein; PDBTitle: structure of the hydroxynitrile lyase from arabidopsis2 thaliana
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40..
Predicted Secondary structure 




















Query SS confidence 








































Query Sequence  KRPNFLFVMTDTQATNMVGCYSGKPLNTQNIDSLAAEGIRF
Query Conservation 





 
  
 

 
 
   
     




 

  

 
Alig confidence 








.........






















Template Conservation 

 





.........
       
      
   
  
Template Sequence  RKHHFVLVH. . . . . . . . . NAYHGAWIWYKLKPLLESAGHRV
Template Known Secondary structure 



.........
TT

GGGGTTTT
Template Predicted Secondary structure 




.........







Template SS confidence 








































   3......10. ........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions