Return to main results Retrieve Phyre Job Id

Job DescriptionP27297
Confidence6.51%DateThu Jan 5 11:43:43 GMT 2012
Rank74Aligned Residues30
% Identity27%Templated1gm5a1
SCOP infoFour-helical up-and-down bundle RecG, N-terminal domain RecG, N-terminal domain
Resolution3.24

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   72.......80.........90.... .....100.
Predicted Secondary structure 
...........
Query SS confidence 






















. . . . . . . . . . .






Query Sequence  SGTPRKKAFLRTVMPYITSQNAA. . . . . . . . . . . ITAERNW
Query Conservation 
   

  
   
 
 
   
  ...........
   
  
Alig confidence 






















...........






Template Conservation   
 

   
  
  


 

 

   





 





 
Template Sequence  DLEEKLQAFLDYVKEIPNLPEARKRYRIQKSLEMIEKLRSW
Template Known Secondary structure  TTSSSS
Template Predicted Secondary structure 



Template SS confidence 








































   58.60.........70.........80.........90........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions