Return to main results Retrieve Phyre Job Id

Job DescriptionP27297
Confidence6.57%DateThu Jan 5 11:43:43 GMT 2012
Rank71Aligned Residues30
% Identity13%Templatec3cerD_
PDB info PDB header:structural genomics, unknown functionChain: D: PDB Molecule:possible exopolyphosphatase-like protein; PDBTitle: crystal structure of the exopolyphosphatase-like protein2 q8g5j2. northeast structural genomics consortium target3 blr13
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   119120.........130.........140.........150.........160.
Predicted Secondary structure 













Query SS confidence 










































Query Sequence  LKDIAKRYKVKWSGNTRKIPWNTLLERVDIIPTSMVATMAAAE
Query Conservation 
  
   
 
             

 





 









Alig confidence 












.............
















Template Conservation     
    

   .............


 
  
  

  

 
Template Sequence  RAERREYKTIHPG. . . . . . . . . . . . . RIDVVGGGAVVWSRVLA
Template Known Secondary structure  T
TTS
GG.............GTTT
Template Predicted Secondary structure 



.............
Template SS confidence 










































   275....280....... ..290.........300....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions