Return to main results Retrieve Phyre Job Id

Job DescriptionP75616
Confidence3.39%DateThu Jan 5 12:12:47 GMT 2012
Rank48Aligned Residues26
% Identity19%Templatec1d8lA_
PDB info PDB header:gene regulationChain: A: PDB Molecule:protein (holliday junction dna helicase ruva); PDBTitle: e. coli holliday junction binding protein ruva nh2 region2 lacking domain iii
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10......... 20........ .30..
Predicted Secondary structure 

......





..


Query SS confidence 












. . . . . .








. .



Query Sequence  IVLALSLVLVAPM. . . . . . AAQAAEITL. . VPSV
Query Conservation    
 
 


  

...... 
 
  
 
.. 


Alig confidence 












......








..



Template Conservation 

 

 


     

  

   
   
 




Template Sequence  PKLALAILSGMSAQQFVNAVEREEVGALVKLPGI
Template Known Secondary structure  S
TT
STT
Template Predicted Secondary structure 








Template SS confidence 

































   83......90.........100.........110......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions