Return to main results Retrieve Phyre Job Id

Job DescriptionP37003
Confidence10.70%DateThu Jan 5 11:54:14 GMT 2012
Rank29Aligned Residues41
% Identity22%Templatec3mcaA_
PDB info PDB header:translation regulation/hydrolaseChain: A: PDB Molecule:elongation factor 1 alpha-like protein; PDBTitle: structure of the dom34-hbs1 complex and implications for its role in2 no-go decay
Resolution2.74 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   52.......60.........70.........80.........90.........100.........110
Predicted Secondary structure 

































Query SS confidence 


























































Query Sequence  SPMGALVYGSGGLLIDNGXLRIAGSGHPRLPRDPVSWTQRPEFAGVRALPIADDVAGVI
Query Conservation 
 





 






 








   
 
    

   
      









 
Alig confidence 
















.......











...........











Template Conservation 

 
 

   
  


 .......


  
   

 ...........
    
    

Template Sequence  TMLGRIMFELGEIIGDA. . . . . . . PGHRDFISGMIA. . . . . . . . . . . AVLVVDSSQNNF
Template Known Secondary structure 



.......SSS


...........

S

S
Template Predicted Secondary structure 


.......

...........

Template SS confidence 


























































   192.......200........ .210.........220 .........230..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions