Return to main results Retrieve Phyre Job Id

Job DescriptionP39285
Confidence23.30%DateThu Jan 5 11:58:57 GMT 2012
Rank323Aligned Residues55
% Identity24%Templatec1yceD_
PDB info PDB header:membrane proteinChain: D: PDB Molecule:subunit c; PDBTitle: structure of the rotor ring of f-type na+-atpase from ilyobacter2 tartaricus
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   880.........890.........900.........910..... ....920..... ....930..
Predicted Secondary structure 


...........................
Query SS confidence 



































. . . . . . . . . . . .









. . . . . . . . . . . . . . .






Query Sequence  LLMLIGGLVGFSMIGIEWSKLQWLVAALGVGLGFGL. . . . . . . . . . . . QEIFANFISG. . . . . . . . . . . . . . . LIILFEK
Query Conservation            
   
     
      
 
 



 ............
    
  

...............  

 
 
Alig confidence 



































............









...............






Template Conservation        
  

  





 

  
 


 
     
 
 





    
   
 

 

 

  













Template Sequence  MLFAKTVVLAASAVGAGTAMIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLYAN
Template Known Secondary structure  GGGG
GGGS
Template Predicted Secondary structure 


Template SS confidence 















































































   3......10.........20.........30.........40.........50.........60.........70.........80..
 
   933.
Predicted Secondary structure 

Query SS confidence 

Query Sequence  PI
Query Conservation 
 
Alig confidence 

Template Conservation 

Template Sequence  PF
Template Known Secondary structure  SS
Template Predicted Secondary structure 
Template SS confidence 

   83.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions