Return to main results Retrieve Phyre Job Id

Job DescriptionP75788
Confidence1.08%DateThu Jan 5 12:14:09 GMT 2012
Rank18Aligned Residues33
% Identity21%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   144.....150.........160.........170.........180......
Predicted Secondary structure 





Query SS confidence 










































Query Sequence  QNILIWGRSGLSFAGFIAQMAPLAGAMMLTLLLLCWCCFPGKA
Query Conservation   


      
 
        
  

                 
Alig confidence 












..........



















Template Conservation 


 







 ..........    
          




Template Sequence  PLTFIAGIYGYPV. . . . . . . . . . VLAVMGVIAVIMVVYFKKKK
Template Known Secondary structure  TTS


..........TTTTS

Template Predicted Secondary structure  ..........

Template SS confidence 










































   303......310..... ....320.........330.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions