Return to main results Retrieve Phyre Job Id

Job DescriptionP75788
Confidence0.39%DateThu Jan 5 12:14:09 GMT 2012
Rank99Aligned Residues28
% Identity25%Templatec2zjsE_
PDB info PDB header:protein transport/immune systemChain: E: PDB Molecule:preprotein translocase sece subunit; PDBTitle: crystal structure of secye translocon from thermus thermophilus with a2 fab fragment
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   238.240........ .250.........260.....
Predicted Secondary structure 



..........
Query SS confidence 










. . . . . . . . . .
















Query Sequence  RRVVLSVDWTL. . . . . . . . . . LLVFMAMFIDVHLLTQL
Query Conservation     
  
 
  ..........

   
   
   
  
Alig confidence 










..........
















Template Conservation 















 








 
  


 
 
 
Template Sequence  RAELARVTWPTREQVVEGTQAILLFTLAFMVILGLYDT
Template Known Secondary structure 








S
SSS
Template Predicted Secondary structure 



Template SS confidence 





































   13......20.........30.........40.........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions