Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA25
Confidence23.52%DateThu Jan 5 11:11:46 GMT 2012
Rank336Aligned Residues60
% Identity17%Templatec3bbyA_
PDB info PDB header:transferaseChain: A: PDB Molecule:uncharacterized gst-like protein yfcf; PDBTitle: crystal structure of glutathione s-transferase (np_416804.1) from2 escherichia coli k12 at 1.85 a resolution
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30. ........40.........50.........60.........70.........80.........90.........
Predicted Secondary structure 



..


























Query SS confidence 









. .



































































Query Sequence  GAILVDFWAE. . WCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQ
Query Conservation 
 
 
 
 
 ..

  
                                    
   

   
  
       
      
Alig confidence 









..





















..................








..







......


Template Conservation   
 
 

      

   
    
 
 

  
  .................. 






 ..     
 
......
 
Template Sequence  KPAITLWSDAHFFSPYVLSAWVALQEKGLSFHIK. . . . . . . . . . . . . . . . . . TIDRVPLLQ. . IDDFELSE. . . . . . SSA
Template Known Secondary structure 


TTS

T


..................



..TTS......
Template Predicted Secondary structure 













..................



..


......
Template SS confidence 















































































   3......10.........20.........30...... ...40..... ....50... ...
 
   100.......
Predicted Secondary structure 
Query SS confidence 







Query Sequence  LKEFLDAN
Query Conservation 
   
 
 
Alig confidence 







Template Conservation 
  

   
Template Sequence  IAEYLEDR
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 







   75....80..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions