Return to main results Retrieve Phyre Job Id

Job DescriptionP45531
Confidence13.91%DateThu Jan 5 12:02:56 GMT 2012
Rank70Aligned Residues30
% Identity33%Templatec3g5rA_
PDB info PDB header:transferaseChain: A: PDB Molecule:methylenetetrahydrofolate--trna-(uracil-5-)- PDBTitle: crystal structure of thermus thermophilus trmfo in complex with2 tetrahydrofolate
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30........
Predicted Secondary structure 











Query SS confidence 





































Query Sequence  MKRIAFVFSTAPHGTAAGREGLDALLATSALTDDLAVF
Query Conservation 

 



    
       
 
  


  
    
 

Alig confidence 







........





















Template Conservation 
  




........

 

 


  


 
  
 
 
Template Sequence  MERVNVVG. . . . . . . . AGLAGSEAAWTLLRLGVPVRLF
Template Known Secondary structure 

S
........
STT

Template Predicted Secondary structure 



........




Template SS confidence 





































   1....... .10.........20.........30
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions