Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
  Protein Homology/analogY Recognition Engine V 2.2
 

Fold library entry viewer: c8a5aX_

Fold library idPDB HeaderMoleculeTitle
c8a5aX_3.30PDB header: dna binding proteinChain: X: PDB Molecule: ino eighty subunit 4;


Added to library: Sat Dec 17 09:02:06 2022
 
Links to external resources


 1........10.........20.........30.........40
Sequence SKPVLPWDYKNKAIEIKSFSGYKVNFTGWIRRDVREERQR
Predicted secondary structure
















SS confidence







































Known secondary structure (DSSP)






TTS
T


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol

Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions