Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7q72C_

Fold library idPDB HeaderMoleculeTitle
c7q72C_2.80PDB header: transferaseChain: C: PDB Molecule: nurs complex subunit red1;


Added to library: Sat Dec 10 09:27:06 2022
 
Links to external resources


 1........10.........20.........30.....
Sequence ISLPLLKQDDWLSSSKPFGSSTPNVVIEFDSDDDG
Predicted secondary structure





























SS confidence


































Known secondary structure (DSSP)

S

S












SSSS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D