Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
  Protein Homology/analogY Recognition Engine V 2.2
 

Fold library entry viewer: c6ynwN_

Fold library idPDB HeaderMoleculeTitle
c6ynwN_3.10PDB header: membrane proteinChain: N: PDB Molecule: subunit c;


Added to library: Sat Oct 3 08:40:38 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MLLVKAVKVLVMGGCMLPIAFGALGTGVLFAGFNVALSRNPEETESLFNNTLMGFALIETFIFMSIGLGF
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP)
T
GGG
 .....
Sequence FVLFA
Predicted secondary structure
SS confidence




Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol

Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions