Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
  Protein Homology/analogY Recognition Engine V 2.2
 

Fold library entry viewer: c6sifG_

Fold library idPDB HeaderMoleculeTitle
c6sifG_1.69PDB header: structural proteinChain: G: PDB Molecule: epidermicin locus structural protein;


Added to library: Sat Aug 29 08:24:09 2020
 
Links to external resources


 1........10.........20.........30.........40.......
Sequence AAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKK
Predicted secondary structure




SS confidence














































Known secondary structure (DSSP)
TT
TT



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol

Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions