Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
  Protein Homology/analogY Recognition Engine V 2.2
 

Fold library entry viewer: c6jnfD_

Fold library idPDB HeaderMoleculeTitle
c6jnfD_3.81PDB header: translocaseChain: D: PDB Molecule: mitochondrial import receptor subunit tom5;


Added to library: Sat Oct 19 08:23:58 2019
 
Links to external resources


 1........10.........20.........30....
Sequence HQEQTEKTLKQAAYVAAFLWVSPMIWHLVKKQWK
Predicted secondary structure


SS confidence

































Known secondary structure (DSSP)

TTSST


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol

Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions