Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
  Protein Homology/analogY Recognition Engine V 2.2
 

Fold library entry viewer: c5l8rI_

Fold library idPDB HeaderMoleculeTitle
c5l8rI_2.60PDB header: oxidoreductaseChain: I: PDB Molecule: photosystem i reaction center subunit viii;


Added to library: Sat Mar 18 08:30:50 2017
 
Links to external resources


 1........10.........20.........30
Sequence NLPSLFVPLVGLLFPAVAMASLFLHVEKRL
Predicted secondary structure



SS confidence





























Known secondary structure (DSSP)
T



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol

Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions