Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d2astb2

Fold library idFoldSuperfamilyFamily
d2astb2Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)RNI-likeCyclin A/CDK2-associated p19, Skp2


Added to library: Tue Mar 16 12:11:38 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQC
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

S
TT
B

TT
S
TT

S


S



B



TT

TTB
 .........80.........90.........100.........110.........120.........130.........140
Sequence SKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQ
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP)


S
TT
B

TT
TT
S
TT
BS


TT





TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence VAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRC
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP) S
TT



S
GGGS

TT
S
TT
TT

GGGGGGGGG
TT


TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCR
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT

GGGGGGGGG
TT


TTSS
TT
STTSS


S

TT
SS
SSTT


BTTB

S
 ....
Sequence LTLQ
Predicted secondary structure
SS confidence



Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D