Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1z7xw1

Fold library idFoldSuperfamilyFamily
d1z7xw1Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)RNI-like28-residue LRR


Added to library: Tue Mar 16 12:10:34 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)




S



TT
SSS


T
TT


TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence GVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQ
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) TT
STT




TTS

BGGGTTS
TT



SSB
TSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence CRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGV
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)




TTS

BGGG
TT



SSB
S





TTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence TSDNCRDLCGIVASKASLRELALGSNKLGDVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLR
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) BTT
TT



SSB
TSTT




TTS


 .........290.........300.........310.........320.........330.........340.........350
Sequence AKESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT


TT


TSTT




TTS

BGGG
SS



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence RLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVES
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) B
TSTT




TTS









SSS

 .........430.........440.........450.........460
Sequence VRQPGCLLEQLVLYDIYWSEEMEDRLQALEKDKPSLRVIS
Predicted secondary structure



















SS confidence







































Known secondary structure (DSSP) TSTT




TT




TTS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D