Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1xwdc1

Fold library idFoldSuperfamilyFamily
d1xwdc1Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)L domain-likeNgr ectodomain-like


Added to library: Tue Mar 16 12:45:11 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIE
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)


SS
SSS
S
SS

S
S
S

SS




TTTTTT
TT

S
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence ADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINI
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP) SSSS
TT



TT


TTS

TT

S



S



TTT
BSS
S
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence HTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISR
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP)

TTSSTTSBSS


SS



TTTTTT


TT
TT




TTTTTTS


S
TT
 .........220.........230.........240..
Sequence TRIHSLPSYGLENLKKLRARSTYNLKKLPTLE
Predicted secondary structure

























SS confidence































Known secondary structure (DSSP) S





SSS
TT

SSSSSS
S




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D