Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1q7ra_

Fold library idFoldSuperfamilyFamily
d1q7ra_Flavodoxin-likeClass I glutamine amidotransferase-likeClass I glutamine amidotransferases (GAT)


Added to library: Tue Mar 16 14:28:47 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LYFQSNXKIGVLGLQGAVREHVRAIEACGAEAVIVKKSEQLEGLDGLVLPGGESTTXRRLIDRYGLXEPL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)






S
GGG
TT

SGGGGTT
S



TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KQFAAAGKPXFGTCAGLILLAKRIVGYDEPHLGLXDITVERNSFGRQRESFEAELSIKGVGDGFVGVFIR
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT

TTSS












TTTSS
 .........150.........160.........170.........180.........190.........200..
Sequence APHIVEAGDGVDVLATYNDRIVAARQGQFLGCSFHPELTDDHRLXQYFLNXVKEAKXASSLK
Predicted secondary structure






















SS confidence





























































Known secondary structure (DSSP)


TT
TTTTSS
GGGSS



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D