Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1okca_

Fold library idFoldSuperfamilyFamily
d1okca_Mitochondrial carrierMitochondrial carrierMitochondrial carrier


Added to library: Tue Mar 16 13:11:13 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DQALSFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

TGGG
SS

GGGS

S
GGGGGT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTT

TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIV
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


SSTTT
S
SS
TTTSS
GGG
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence SWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGM
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTT

GGG
S
SS
GGGGGTT
 .........290..
Sequence GGAFVLVLYDEI
Predicted secondary structure

SS confidence











Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D